Anti FUCA1 pAb (ATL-HPA056371 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA056371-25

• 
• 

Product Description

Protein Description: fucosidase, alpha-L- 1, tissue
Gene Name: FUCA1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028673: 94%, ENSRNOG00000009325: 90%
Entrez Gene ID: 2517
Uniprot ID: P04066
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RDLVGELGTALRKRNIRYGLYHSLLEWFHPLYLLDKKNGFKTQHFVSAKTMPELYDLVNSYKPDLIWSDGEWECPDTYWNSTNFLSWL
• Gene Sequence: RDLVGELGTALRKRNIRYGLYHSLLEWFHPLYLLDKKNGFKTQHFVSAKTMPELYDLVNSYKPDLIWSDGEWECPDTYWNSTNFLSWL
• Gene ID - Mouse: ENSMUSG00000028673
• Gene ID - Rat: ENSRNOG00000009325
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti FUCA1 pAb (ATL-HPA056371 w/enhanced validation) – 1 Found

Wang, Yutao; Yan, Kexin; Lin, Jiaxing; Li, Jun; Bi, Jianbin. Macrophage M2 Co-expression Factors Correlate With the Immune Microenvironment and Predict Outcome of Renal Clear Cell Carcinoma. Frontiers In Genetics. 12( 33692827):615655.