Description
Product Description
Protein Description: FtsJ homolog 3 (E. coli)
Gene Name: FTSJ3
Alternative Gene Name: SPB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020706: 69%, ENSRNOG00000009857: 67%
Entrez Gene ID: 117246
Uniprot ID: Q8IY81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FTSJ3
Alternative Gene Name: SPB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020706: 69%, ENSRNOG00000009857: 67%
Entrez Gene ID: 117246
Uniprot ID: Q8IY81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KAVLQEEQANLWFSKGSFAGIEDDADEALEISQAQLLFENRRKGRQQQQKQQLPQTPPSCLKTE |
Gene Sequence | KAVLQEEQANLWFSKGSFAGIEDDADEALEISQAQLLFENRRKGRQQQQKQQLPQTPPSCLKTE |
Gene ID - Mouse | ENSMUSG00000020706 |
Gene ID - Rat | ENSRNOG00000009857 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti FTSJ3 pAb (ATL-HPA062628) | |
Datasheet | Anti FTSJ3 pAb (ATL-HPA062628) Datasheet (External Link) |
Vendor Page | Anti FTSJ3 pAb (ATL-HPA062628) at Atlas Antibodies |
Documents & Links for Anti FTSJ3 pAb (ATL-HPA062628) | |
Datasheet | Anti FTSJ3 pAb (ATL-HPA062628) Datasheet (External Link) |
Vendor Page | Anti FTSJ3 pAb (ATL-HPA062628) |