Protein Description: fascin actin-bundling protein 3
Gene Name: FSCN3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029707: 85%, ENSRNOG00000007942: 82%
Entrez Gene ID: 29999
Uniprot ID: Q9NQT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FSCN3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029707: 85%, ENSRNOG00000007942: 82%
Entrez Gene ID: 29999
Uniprot ID: Q9NQT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TSHVLSAYHMWTPRPALHVHVILYSPIHRCYARADPTMGRIWVDAAVPCLEECGFLLHFRDGCYHLETSTHHFLSHVDRLFSQPS |
Documents & Links for Anti FSCN3 pAb (ATL-HPA075174 w/enhanced validation) | |
Datasheet | Anti FSCN3 pAb (ATL-HPA075174 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FSCN3 pAb (ATL-HPA075174 w/enhanced validation) at Atlas |
Documents & Links for Anti FSCN3 pAb (ATL-HPA075174 w/enhanced validation) | |
Datasheet | Anti FSCN3 pAb (ATL-HPA075174 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FSCN3 pAb (ATL-HPA075174 w/enhanced validation) |