Protein Description: fascin actin-bundling protein 2, retinal
Gene Name: FSCN2
Alternative Gene Name: RFSN, RP30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025380: 89%, ENSRNOG00000036700: 93%
Entrez Gene ID: 25794
Uniprot ID: O14926
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FSCN2
Alternative Gene Name: RFSN, RP30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025380: 89%, ENSRNOG00000036700: 93%
Entrez Gene ID: 25794
Uniprot ID: O14926
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | HRYVSVRQGVNVSANQDDELDHETFLMQIDQETKKCTFYSSTGGYWTLVTHGGIHATATQVSANTMFEMEWRG |
| Documents & Links for Anti FSCN2 pAb (ATL-HPA079270) | |
| Datasheet | Anti FSCN2 pAb (ATL-HPA079270) Datasheet (External Link) |
| Vendor Page | Anti FSCN2 pAb (ATL-HPA079270) at Atlas |
| Documents & Links for Anti FSCN2 pAb (ATL-HPA079270) | |
| Datasheet | Anti FSCN2 pAb (ATL-HPA079270) Datasheet (External Link) |
| Vendor Page | Anti FSCN2 pAb (ATL-HPA079270) |