Anti FSCN2 pAb (ATL-HPA079270)

Atlas Antibodies

Catalog No: ATL-HPA079270-25

• 

Product Description

Protein Description: fascin actin-bundling protein 2, retinal
Gene Name: FSCN2
Alternative Gene Name: RFSN, RP30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025380: 89%, ENSRNOG00000036700: 93%
Entrez Gene ID: 25794
Uniprot ID: O14926
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HRYVSVRQGVNVSANQDDELDHETFLMQIDQETKKCTFYSSTGGYWTLVTHGGIHATATQVSANTMFEMEWRG
• Gene Sequence: HRYVSVRQGVNVSANQDDELDHETFLMQIDQETKKCTFYSSTGGYWTLVTHGGIHATATQVSANTMFEMEWRG
• Gene ID - Mouse: ENSMUSG00000025380
• Gene ID - Rat: ENSRNOG00000036700
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.