Anti FRRS1L pAb (ATL-HPA071086 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA071086-25

• 

Product Description

Protein Description: ferric-chelate reductase 1-like
Gene Name: FRRS1L
Alternative Gene Name: C9orf4, CG-6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045589: 95%, ENSRNOG00000043103: 97%
Entrez Gene ID: 23732
Uniprot ID: Q9P0K9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RHDSSYGTFAGEFYDLRYLSEEGYPFPTAPPVDPFAKIKVDDCGKTKGCFRYGKPGCNAETC
• Gene Sequence: RHDSSYGTFAGEFYDLRYLSEEGYPFPTAPPVDPFAKIKVDDCGKTKGCFRYGKPGCNAETC
• Gene ID - Mouse: ENSMUSG00000045589
• Gene ID - Rat: ENSRNOG00000043103
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.