Protein Description: ferric-chelate reductase 1-like
Gene Name: FRRS1L
Alternative Gene Name: C9orf4, CG-6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045589: 95%, ENSRNOG00000043103: 97%
Entrez Gene ID: 23732
Uniprot ID: Q9P0K9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FRRS1L
Alternative Gene Name: C9orf4, CG-6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045589: 95%, ENSRNOG00000043103: 97%
Entrez Gene ID: 23732
Uniprot ID: Q9P0K9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RHDSSYGTFAGEFYDLRYLSEEGYPFPTAPPVDPFAKIKVDDCGKTKGCFRYGKPGCNAETC |
| Documents & Links for Anti FRRS1L pAb (ATL-HPA071086 w/enhanced validation) | |
| Datasheet | Anti FRRS1L pAb (ATL-HPA071086 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FRRS1L pAb (ATL-HPA071086 w/enhanced validation) at Atlas |
| Documents & Links for Anti FRRS1L pAb (ATL-HPA071086 w/enhanced validation) | |
| Datasheet | Anti FRRS1L pAb (ATL-HPA071086 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FRRS1L pAb (ATL-HPA071086 w/enhanced validation) |