Protein Description: forkhead box O3
Gene Name: FOXO3
Alternative Gene Name: AF6q21, FKHRL1, FOXO2, FOXO3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048756: 95%, ENSRNOG00000000299: 95%
Entrez Gene ID: 2309
Uniprot ID: O43524
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FOXO3
Alternative Gene Name: AF6q21, FKHRL1, FOXO2, FOXO3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048756: 95%, ENSRNOG00000000299: 95%
Entrez Gene ID: 2309
Uniprot ID: O43524
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSVVNQNLLHHQHQTQGALGGSRALS |
| Documents & Links for Anti FOXO3 pAb (ATL-HPA063104) | |
| Datasheet | Anti FOXO3 pAb (ATL-HPA063104) Datasheet (External Link) |
| Vendor Page | Anti FOXO3 pAb (ATL-HPA063104) at Atlas |
| Documents & Links for Anti FOXO3 pAb (ATL-HPA063104) | |
| Datasheet | Anti FOXO3 pAb (ATL-HPA063104) Datasheet (External Link) |
| Vendor Page | Anti FOXO3 pAb (ATL-HPA063104) |