Protein Description: forkhead box K2
Gene Name: FOXK2
Alternative Gene Name: ILF, ILF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039275: 86%, ENSRNOG00000036663: 69%
Entrez Gene ID: 3607
Uniprot ID: Q01167
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FOXK2
Alternative Gene Name: ILF, ILF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039275: 86%, ENSRNOG00000036663: 69%
Entrez Gene ID: 3607
Uniprot ID: Q01167
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GTHVASVPTAVHGQVNNAAASPLHMLATHASASASLPTKRHNGDQPEQPELKRIKTEDGEGIVIALSVDTPPAAVRE |
| Documents & Links for Anti FOXK2 pAb (ATL-HPA073491) | |
| Datasheet | Anti FOXK2 pAb (ATL-HPA073491) Datasheet (External Link) |
| Vendor Page | Anti FOXK2 pAb (ATL-HPA073491) at Atlas |
| Documents & Links for Anti FOXK2 pAb (ATL-HPA073491) | |
| Datasheet | Anti FOXK2 pAb (ATL-HPA073491) Datasheet (External Link) |
| Vendor Page | Anti FOXK2 pAb (ATL-HPA073491) |