Protein Description: forkhead box J3
Gene Name: FOXJ3
Alternative Gene Name: KIAA1041
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032998: 95%, ENSRNOG00000061851: 98%
Entrez Gene ID: 22887
Uniprot ID: Q9UPW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FOXJ3
Alternative Gene Name: KIAA1041
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032998: 95%, ENSRNOG00000061851: 98%
Entrez Gene ID: 22887
Uniprot ID: Q9UPW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GMECIISGSASPTLAINTVTNKVTLYNTDQDGSDSPRSSLNNSLSDQSLASVNLNSVGSVHSYTPVTSHPESVSQSLTPQQQ |
| Documents & Links for Anti FOXJ3 pAb (ATL-HPA067284) | |
| Datasheet | Anti FOXJ3 pAb (ATL-HPA067284) Datasheet (External Link) |
| Vendor Page | Anti FOXJ3 pAb (ATL-HPA067284) at Atlas |
| Documents & Links for Anti FOXJ3 pAb (ATL-HPA067284) | |
| Datasheet | Anti FOXJ3 pAb (ATL-HPA067284) Datasheet (External Link) |
| Vendor Page | Anti FOXJ3 pAb (ATL-HPA067284) |