Protein Description: forkhead box I1
Gene Name: FOXI1
Alternative Gene Name: FKHL10, FREAC6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047861: 69%, ENSRNOG00000006293: 69%
Entrez Gene ID: 2299
Uniprot ID: Q12951
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FOXI1
Alternative Gene Name: FKHL10, FREAC6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047861: 69%, ENSRNOG00000006293: 69%
Entrez Gene ID: 2299
Uniprot ID: Q12951
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TSHPLVTPGLSPEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNMLSYGGSVLSQFSPHFYNSVNTSG |
Documents & Links for Anti FOXI1 pAb (ATL-HPA071469 w/enhanced validation) | |
Datasheet | Anti FOXI1 pAb (ATL-HPA071469 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FOXI1 pAb (ATL-HPA071469 w/enhanced validation) at Atlas |
Documents & Links for Anti FOXI1 pAb (ATL-HPA071469 w/enhanced validation) | |
Datasheet | Anti FOXI1 pAb (ATL-HPA071469 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FOXI1 pAb (ATL-HPA071469 w/enhanced validation) |
Citations for Anti FOXI1 pAb (ATL-HPA071469 w/enhanced validation) – 4 Found |
Plasschaert, Lindsey W; Žilionis, Rapolas; Choo-Wing, Rayman; Savova, Virginia; Knehr, Judith; Roma, Guglielmo; Klein, Allon M; Jaffe, Aron B. A single-cell atlas of the airway epithelium reveals the CFTR-rich pulmonary ionocyte. Nature. 2018;560(7718):377-381. PubMed |
Wang, Guoqing; Lou, Howard H; Salit, Jacqueline; Leopold, Philip L; Driscoll, Sharon; Schymeinsky, Juergen; Quast, Karsten; Visvanathan, Sudha; Fine, Jay S; Thomas, Matthew J; Crystal, Ronald G. Characterization of an immortalized human small airway basal stem/progenitor cell line with airway region-specific differentiation capacity. Respiratory Research. 2019;20(1):196. PubMed |
Liu, Zhongyu; Anderson, Justin D; Deng, Lily; Mackay, Stephen; Bailey, Johnathan; Kersh, Latona; Rowe, Steven M; Guimbellot, Jennifer S. Human Nasal Epithelial Organoids for Therapeutic Development in Cystic Fibrosis. Genes. 2020;11(6) PubMed |
Scudieri, Paolo; Musante, Ilaria; Venturini, Arianna; Guidone, Daniela; Genovese, Michele; Cresta, Federico; Caci, Emanuela; Palleschi, Alessandro; Poeta, Marco; Santamaria, Francesca; Ciciriello, Fabiana; Lucidi, Vincenzina; Galietta, Luis J V. Ionocytes and CFTR Chloride Channel Expression in Normal and Cystic Fibrosis Nasal and Bronchial Epithelial Cells. Cells. 2020;9(9) PubMed |