Protein Description: forkhead box B2
Gene Name: FOXB2
Alternative Gene Name: bA159H20.4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056829: 96%, ENSRNOG00000032137: 96%
Entrez Gene ID: 442425
Uniprot ID: Q5VYV0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FOXB2
Alternative Gene Name: bA159H20.4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056829: 96%, ENSRNOG00000032137: 96%
Entrez Gene ID: 442425
Uniprot ID: Q5VYV0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | IGRDYKGVLQAGGLPLASVMHHLGYPVPGQLGNVVSSVWPHVGVMD |
Documents & Links for Anti FOXB2 pAb (ATL-HPA067947) | |
Datasheet | Anti FOXB2 pAb (ATL-HPA067947) Datasheet (External Link) |
Vendor Page | Anti FOXB2 pAb (ATL-HPA067947) at Atlas |
Documents & Links for Anti FOXB2 pAb (ATL-HPA067947) | |
Datasheet | Anti FOXB2 pAb (ATL-HPA067947) Datasheet (External Link) |
Vendor Page | Anti FOXB2 pAb (ATL-HPA067947) |