Anti FOXB2 pAb (ATL-HPA067947)

Atlas Antibodies

Catalog No: ATL-HPA067947-25

• 

Product Description

Protein Description: forkhead box B2
Gene Name: FOXB2
Alternative Gene Name: bA159H20.4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056829: 96%, ENSRNOG00000032137: 96%
Entrez Gene ID: 442425
Uniprot ID: Q5VYV0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IGRDYKGVLQAGGLPLASVMHHLGYPVPGQLGNVVSSVWPHVGVMD
• Gene Sequence: IGRDYKGVLQAGGLPLASVMHHLGYPVPGQLGNVVSSVWPHVGVMD
• Gene ID - Mouse: ENSMUSG00000056829
• Gene ID - Rat: ENSRNOG00000032137
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.