Protein Description: forkhead box A2
Gene Name: FOXA2
Alternative Gene Name: HNF3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037025: 96%, ENSRNOG00000013133: 94%
Entrez Gene ID: 3170
Uniprot ID: Q9Y261
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FOXA2
Alternative Gene Name: HNF3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037025: 96%, ENSRNOG00000013133: 94%
Entrez Gene ID: 3170
Uniprot ID: Q9Y261
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTS |
| Documents & Links for Anti FOXA2 pAb (ATL-HPA066846) | |
| Datasheet | Anti FOXA2 pAb (ATL-HPA066846) Datasheet (External Link) |
| Vendor Page | Anti FOXA2 pAb (ATL-HPA066846) at Atlas |
| Documents & Links for Anti FOXA2 pAb (ATL-HPA066846) | |
| Datasheet | Anti FOXA2 pAb (ATL-HPA066846) Datasheet (External Link) |
| Vendor Page | Anti FOXA2 pAb (ATL-HPA066846) |