Protein Description: FOS-like antigen 1
Gene Name: FOSL1
Alternative Gene Name: fra-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024912: 88%, ENSRNOG00000020552: 96%
Entrez Gene ID: 8061
Uniprot ID: P15407
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FOSL1
Alternative Gene Name: fra-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024912: 88%, ENSRNOG00000020552: 96%
Entrez Gene ID: 8061
Uniprot ID: P15407
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPE |
| Documents & Links for Anti FOSL1 pAb (ATL-HPA066901) | |
| Datasheet | Anti FOSL1 pAb (ATL-HPA066901) Datasheet (External Link) |
| Vendor Page | Anti FOSL1 pAb (ATL-HPA066901) at Atlas |
| Documents & Links for Anti FOSL1 pAb (ATL-HPA066901) | |
| Datasheet | Anti FOSL1 pAb (ATL-HPA066901) Datasheet (External Link) |
| Vendor Page | Anti FOSL1 pAb (ATL-HPA066901) |