Anti FOSL1 pAb (ATL-HPA066901)

Catalog No:
ATL-HPA066901-25
$395.00

Description

Product Description

Protein Description: FOS-like antigen 1
Gene Name: FOSL1
Alternative Gene Name: fra-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024912: 88%, ENSRNOG00000020552: 96%
Entrez Gene ID: 8061
Uniprot ID: P15407
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPE
Gene Sequence LVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPE
Gene ID - Mouse ENSMUSG00000024912
Gene ID - Rat ENSRNOG00000020552
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti FOSL1 pAb (ATL-HPA066901)
Datasheet Anti FOSL1 pAb (ATL-HPA066901) Datasheet (External Link)
Vendor Page Anti FOSL1 pAb (ATL-HPA066901) at Atlas Antibodies

Documents & Links for Anti FOSL1 pAb (ATL-HPA066901)
Datasheet Anti FOSL1 pAb (ATL-HPA066901) Datasheet (External Link)
Vendor Page Anti FOSL1 pAb (ATL-HPA066901)

Product Description

Protein Description: FOS-like antigen 1
Gene Name: FOSL1
Alternative Gene Name: fra-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024912: 88%, ENSRNOG00000020552: 96%
Entrez Gene ID: 8061
Uniprot ID: P15407
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPE
Gene Sequence LVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPE
Gene ID - Mouse ENSMUSG00000024912
Gene ID - Rat ENSRNOG00000020552
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti FOSL1 pAb (ATL-HPA066901)
Datasheet Anti FOSL1 pAb (ATL-HPA066901) Datasheet (External Link)
Vendor Page Anti FOSL1 pAb (ATL-HPA066901) at Atlas Antibodies

Documents & Links for Anti FOSL1 pAb (ATL-HPA066901)
Datasheet Anti FOSL1 pAb (ATL-HPA066901) Datasheet (External Link)
Vendor Page Anti FOSL1 pAb (ATL-HPA066901)