Anti FNTB pAb (ATL-HPA062743)

Atlas Antibodies

Catalog No: ATL-HPA062743-25

• 
• 
• 

Product Description

Protein Description: farnesyltransferase, CAAX box, beta
Gene Name: FNTB
Alternative Gene Name: FPTB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033373: 96%, ENSRNOG00000007660: 98%
Entrez Gene ID: 2342
Uniprot ID: P49356
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEK
• Gene Sequence: MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEK
• Gene ID - Mouse: ENSMUSG00000033373
• Gene ID - Rat: ENSRNOG00000007660
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.