Protein Description: folliculin interacting protein 2
Gene Name: FNIP2
Alternative Gene Name: FNIPL, KIAA1450, MAPO1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022218: 33%, ENSRNOG00000027833: 30%
Entrez Gene ID: 57600
Uniprot ID: Q9P278
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FNIP2
Alternative Gene Name: FNIPL, KIAA1450, MAPO1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022218: 33%, ENSRNOG00000027833: 30%
Entrez Gene ID: 57600
Uniprot ID: Q9P278
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GFQENVCCPQNRLSEGDEGESDKGFAEDRGSRNDMAADIAGQLSHAADLGTASHGAGGTGGRRLEATRGLYVKAAEGPVLE |
| Documents & Links for Anti FNIP2 pAb (ATL-HPA072420) | |
| Datasheet | Anti FNIP2 pAb (ATL-HPA072420) Datasheet (External Link) |
| Vendor Page | Anti FNIP2 pAb (ATL-HPA072420) at Atlas |
| Documents & Links for Anti FNIP2 pAb (ATL-HPA072420) | |
| Datasheet | Anti FNIP2 pAb (ATL-HPA072420) Datasheet (External Link) |
| Vendor Page | Anti FNIP2 pAb (ATL-HPA072420) |