Protein Description: folliculin interacting protein 1
Gene Name: FNIP1
Alternative Gene Name: KIAA1961
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035992: 77%, ENSRNOG00000009104: 82%
Entrez Gene ID: 96459
Uniprot ID: Q8TF40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FNIP1
Alternative Gene Name: KIAA1961
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035992: 77%, ENSRNOG00000009104: 82%
Entrez Gene ID: 96459
Uniprot ID: Q8TF40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DHCCMLEFSKILCTKNNKQNNEFCKCIETVPQDSCKTCFPQQDQRDTLSILVPHGDKESSDKKIAVGTEWD |
| Documents & Links for Anti FNIP1 pAb (ATL-HPA071213) | |
| Datasheet | Anti FNIP1 pAb (ATL-HPA071213) Datasheet (External Link) |
| Vendor Page | Anti FNIP1 pAb (ATL-HPA071213) at Atlas |
| Documents & Links for Anti FNIP1 pAb (ATL-HPA071213) | |
| Datasheet | Anti FNIP1 pAb (ATL-HPA071213) Datasheet (External Link) |
| Vendor Page | Anti FNIP1 pAb (ATL-HPA071213) |