Anti FNIP1 pAb (ATL-HPA071213)

Catalog No:
ATL-HPA071213-25
$447.00

Description

Product Description

Protein Description: folliculin interacting protein 1
Gene Name: FNIP1
Alternative Gene Name: KIAA1961
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035992: 77%, ENSRNOG00000009104: 82%
Entrez Gene ID: 96459
Uniprot ID: Q8TF40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DHCCMLEFSKILCTKNNKQNNEFCKCIETVPQDSCKTCFPQQDQRDTLSILVPHGDKESSDKKIAVGTEWD
Gene Sequence DHCCMLEFSKILCTKNNKQNNEFCKCIETVPQDSCKTCFPQQDQRDTLSILVPHGDKESSDKKIAVGTEWD
Gene ID - Mouse ENSMUSG00000035992
Gene ID - Rat ENSRNOG00000009104
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti FNIP1 pAb (ATL-HPA071213)
Datasheet Anti FNIP1 pAb (ATL-HPA071213) Datasheet (External Link)
Vendor Page Anti FNIP1 pAb (ATL-HPA071213) at Atlas Antibodies

Documents & Links for Anti FNIP1 pAb (ATL-HPA071213)
Datasheet Anti FNIP1 pAb (ATL-HPA071213) Datasheet (External Link)
Vendor Page Anti FNIP1 pAb (ATL-HPA071213)

Product Description

Protein Description: folliculin interacting protein 1
Gene Name: FNIP1
Alternative Gene Name: KIAA1961
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035992: 77%, ENSRNOG00000009104: 82%
Entrez Gene ID: 96459
Uniprot ID: Q8TF40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DHCCMLEFSKILCTKNNKQNNEFCKCIETVPQDSCKTCFPQQDQRDTLSILVPHGDKESSDKKIAVGTEWD
Gene Sequence DHCCMLEFSKILCTKNNKQNNEFCKCIETVPQDSCKTCFPQQDQRDTLSILVPHGDKESSDKKIAVGTEWD
Gene ID - Mouse ENSMUSG00000035992
Gene ID - Rat ENSRNOG00000009104
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti FNIP1 pAb (ATL-HPA071213)
Datasheet Anti FNIP1 pAb (ATL-HPA071213) Datasheet (External Link)
Vendor Page Anti FNIP1 pAb (ATL-HPA071213) at Atlas Antibodies

Documents & Links for Anti FNIP1 pAb (ATL-HPA071213)
Datasheet Anti FNIP1 pAb (ATL-HPA071213) Datasheet (External Link)
Vendor Page Anti FNIP1 pAb (ATL-HPA071213)