Protein Description: folliculin interacting protein 1
Gene Name: FNIP1
Alternative Gene Name: KIAA1961
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035992: 79%, ENSRNOG00000009104: 79%
Entrez Gene ID: 96459
Uniprot ID: Q8TF40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FNIP1
Alternative Gene Name: KIAA1961
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035992: 79%, ENSRNOG00000009104: 79%
Entrez Gene ID: 96459
Uniprot ID: Q8TF40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | HHTKPLKEERGAIDQHQETKQTTKDQSGESDTQNMVSEEPCELPCWNHSDPESMSLFDEYFNDDSIETRTIDDVPF |
Documents & Links for Anti FNIP1 pAb (ATL-HPA068099) | |
Datasheet | Anti FNIP1 pAb (ATL-HPA068099) Datasheet (External Link) |
Vendor Page | Anti FNIP1 pAb (ATL-HPA068099) at Atlas |
Documents & Links for Anti FNIP1 pAb (ATL-HPA068099) | |
Datasheet | Anti FNIP1 pAb (ATL-HPA068099) Datasheet (External Link) |
Vendor Page | Anti FNIP1 pAb (ATL-HPA068099) |