Anti FNDC4 pAb (ATL-HPA063581)

Atlas Antibodies

Catalog No: ATL-HPA063581-25

• 
• 

Product Description

Protein Description: fibronectin type III domain containing 4
Gene Name: FNDC4
Alternative Gene Name: FLJ22362, FRCP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038552: 100%, ENSRNOG00000030238: 63%
Entrez Gene ID: 64838
Uniprot ID: Q9H6D8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTT
• Gene Sequence: PPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTT
• Gene ID - Mouse: ENSMUSG00000038552
• Gene ID - Rat: ENSRNOG00000030238
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.