Protein Description: fibronectin type III domain containing 4
Gene Name: FNDC4
Alternative Gene Name: FLJ22362, FRCP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038552: 100%, ENSRNOG00000030238: 63%
Entrez Gene ID: 64838
Uniprot ID: Q9H6D8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FNDC4
Alternative Gene Name: FLJ22362, FRCP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038552: 100%, ENSRNOG00000030238: 63%
Entrez Gene ID: 64838
Uniprot ID: Q9H6D8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTT |
Documents & Links for Anti FNDC4 pAb (ATL-HPA063581) | |
Datasheet | Anti FNDC4 pAb (ATL-HPA063581) Datasheet (External Link) |
Vendor Page | Anti FNDC4 pAb (ATL-HPA063581) at Atlas |
Documents & Links for Anti FNDC4 pAb (ATL-HPA063581) | |
Datasheet | Anti FNDC4 pAb (ATL-HPA063581) Datasheet (External Link) |
Vendor Page | Anti FNDC4 pAb (ATL-HPA063581) |