Description
Product Description
Protein Description: fructosamine 3 kinase related protein
Gene Name: FN3KRP
Alternative Gene Name: FLJ12171, FN3KL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039253: 80%, ENSRNOG00000036660: 83%
Entrez Gene ID: 79672
Uniprot ID: Q9HA64
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FN3KRP
Alternative Gene Name: FLJ12171, FN3KL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039253: 80%, ENSRNOG00000036660: 83%
Entrez Gene ID: 79672
Uniprot ID: Q9HA64
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GSVLVMEHMDMRHLSSHAAKLGAQLADLHLDNKKLGEMRLKEAGTVGRGGGQEERPFVARFGFDVVTCCGYLPQVNDWQEDWVVFYARQRIQPQMD |
Gene Sequence | GSVLVMEHMDMRHLSSHAAKLGAQLADLHLDNKKLGEMRLKEAGTVGRGGGQEERPFVARFGFDVVTCCGYLPQVNDWQEDWVVFYARQRIQPQMD |
Gene ID - Mouse | ENSMUSG00000039253 |
Gene ID - Rat | ENSRNOG00000036660 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti FN3KRP pAb (ATL-HPA065831) | |
Datasheet | Anti FN3KRP pAb (ATL-HPA065831) Datasheet (External Link) |
Vendor Page | Anti FN3KRP pAb (ATL-HPA065831) at Atlas Antibodies |
Documents & Links for Anti FN3KRP pAb (ATL-HPA065831) | |
Datasheet | Anti FN3KRP pAb (ATL-HPA065831) Datasheet (External Link) |
Vendor Page | Anti FN3KRP pAb (ATL-HPA065831) |