![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/99705/179354/atl-hpa065831_anti-fn3krp-pab-atl-hpa065831_61016__53893.1681135030.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG")
Protein Description: fructosamine 3 kinase related protein
Gene Name: FN3KRP
Alternative Gene Name: FLJ12171, FN3KL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039253: 80%, ENSRNOG00000036660: 83%
Entrez Gene ID: 79672
Uniprot ID: Q9HA64
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FN3KRP
Alternative Gene Name: FLJ12171, FN3KL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039253: 80%, ENSRNOG00000036660: 83%
Entrez Gene ID: 79672
Uniprot ID: Q9HA64
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GSVLVMEHMDMRHLSSHAAKLGAQLADLHLDNKKLGEMRLKEAGTVGRGGGQEERPFVARFGFDVVTCCGYLPQVNDWQEDWVVFYARQRIQPQMD |
| Documents & Links for Anti FN3KRP pAb (ATL-HPA065831) | |
| Datasheet | Anti FN3KRP pAb (ATL-HPA065831) Datasheet (External Link) |
| Vendor Page | Anti FN3KRP pAb (ATL-HPA065831) at Atlas |
| Documents & Links for Anti FN3KRP pAb (ATL-HPA065831) | |
| Datasheet | Anti FN3KRP pAb (ATL-HPA065831) Datasheet (External Link) |
| Vendor Page | Anti FN3KRP pAb (ATL-HPA065831) |