Anti FMO4 pAb (ATL-HPA072438)

Atlas Antibodies

Catalog No: ATL-HPA072438-25

• 

Product Description

Protein Description: flavin containing monooxygenase 4
Gene Name: FMO4
Alternative Gene Name: FMO2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026692: 68%, ENSRNOG00000003400: 73%
Entrez Gene ID: 2329
Uniprot ID: P31512
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WGYPYNMMVTRRCCSFIAQVLPSRFLNWIQERKLNKRFNHEDYGLSITKGKKAKFIVNDELPNCILCGAITMNTS
• Gene Sequence: WGYPYNMMVTRRCCSFIAQVLPSRFLNWIQERKLNKRFNHEDYGLSITKGKKAKFIVNDELPNCILCGAITMNTS
• Gene ID - Mouse: ENSMUSG00000026692
• Gene ID - Rat: ENSRNOG00000003400
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.