Protein Description: flavin containing monooxygenase 1
Gene Name: FMO1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040181: 69%, ENSRNOG00000034191: 71%
Entrez Gene ID: 2326
Uniprot ID: Q01740
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FMO1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040181: 69%, ENSRNOG00000034191: 71%
Entrez Gene ID: 2326
Uniprot ID: Q01740
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FPFPEDYPNYVPNSQFLEYLKMYANHFDLLKHIQFKTKVCSVTKCSDSAVS |
| Documents & Links for Anti FMO1 pAb (ATL-HPA078132) | |
| Datasheet | Anti FMO1 pAb (ATL-HPA078132) Datasheet (External Link) |
| Vendor Page | Anti FMO1 pAb (ATL-HPA078132) at Atlas |
| Documents & Links for Anti FMO1 pAb (ATL-HPA078132) | |
| Datasheet | Anti FMO1 pAb (ATL-HPA078132) Datasheet (External Link) |
| Vendor Page | Anti FMO1 pAb (ATL-HPA078132) |