Protein Description: fms related tyrosine kinase 4
Gene Name: FLT4
Alternative Gene Name: PCL, VEGFR3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020357: 75%, ENSRNOG00000002511: 74%
Entrez Gene ID: 2324
Uniprot ID: P35916
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FLT4
Alternative Gene Name: PCL, VEGFR3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020357: 75%, ENSRNOG00000002511: 74%
Entrez Gene ID: 2324
Uniprot ID: P35916
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LQEEEEVCMAPRSSQSSEEGSFSQVSTMALHIAQADAEDSPPSLQRHSLAARYYNWVSFPGCLARGAETRGSSRMKTFEEFPMTPTTYK |
| Documents & Links for Anti FLT4 pAb (ATL-HPA067906) | |
| Datasheet | Anti FLT4 pAb (ATL-HPA067906) Datasheet (External Link) |
| Vendor Page | Anti FLT4 pAb (ATL-HPA067906) at Atlas |
| Documents & Links for Anti FLT4 pAb (ATL-HPA067906) | |
| Datasheet | Anti FLT4 pAb (ATL-HPA067906) Datasheet (External Link) |
| Vendor Page | Anti FLT4 pAb (ATL-HPA067906) |