Anti FLOT2 pAb (ATL-HPA071038)

Atlas Antibodies

Catalog No: ATL-HPA071038-100

• 
• 

Product Description

Protein Description: flotillin 2
Gene Name: FLOT2
Alternative Gene Name: ECS-1, ECS1, ESA, ESA1, M17S1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061981: 97%, ENSRNOG00000009681: 97%
Entrez Gene ID: 2319
Uniprot ID: Q14254
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQ
• Gene Sequence: VIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQ
• Gene ID - Mouse: ENSMUSG00000061981
• Gene ID - Rat: ENSRNOG00000009681
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.