![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/100690/180638/atl-hpa071038_anti-flot2-pab-atl-hpa071038_62306__30580.1681136776.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG")
Protein Description: flotillin 2
Gene Name: FLOT2
Alternative Gene Name: ECS-1, ECS1, ESA, ESA1, M17S1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061981: 97%, ENSRNOG00000009681: 97%
Entrez Gene ID: 2319
Uniprot ID: Q14254
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FLOT2
Alternative Gene Name: ECS-1, ECS1, ESA, ESA1, M17S1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061981: 97%, ENSRNOG00000009681: 97%
Entrez Gene ID: 2319
Uniprot ID: Q14254
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQ |
| Documents & Links for Anti FLOT2 pAb (ATL-HPA071038) | |
| Datasheet | Anti FLOT2 pAb (ATL-HPA071038) Datasheet (External Link) |
| Vendor Page | Anti FLOT2 pAb (ATL-HPA071038) at Atlas |
| Documents & Links for Anti FLOT2 pAb (ATL-HPA071038) | |
| Datasheet | Anti FLOT2 pAb (ATL-HPA071038) Datasheet (External Link) |
| Vendor Page | Anti FLOT2 pAb (ATL-HPA071038) |