Protein Description: filamin C
Gene Name: FLNC
Alternative Gene Name: ABP-280, ABPL, FLN2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068699: 100%, ENSRNOG00000007281: 100%
Entrez Gene ID: 2318
Uniprot ID: Q14315
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FLNC
Alternative Gene Name: ABP-280, ABPL, FLN2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068699: 100%, ENSRNOG00000007281: 100%
Entrez Gene ID: 2318
Uniprot ID: Q14315
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPAVFGDFLGRERLGSFGSITRQQEGEASSQ |
| Documents & Links for Anti FLNC pAb (ATL-HPA071007 w/enhanced validation) | |
| Datasheet | Anti FLNC pAb (ATL-HPA071007 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FLNC pAb (ATL-HPA071007 w/enhanced validation) at Atlas |
| Documents & Links for Anti FLNC pAb (ATL-HPA071007 w/enhanced validation) | |
| Datasheet | Anti FLNC pAb (ATL-HPA071007 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FLNC pAb (ATL-HPA071007 w/enhanced validation) |