Protein Description: Fli-1 proto-oncogene, ETS transcription factor
Gene Name: FLI1
Alternative Gene Name: EWSR2, SIC-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016087: 90%, ENSRNOG00000008904: 87%
Entrez Gene ID: 2313
Uniprot ID: Q01543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FLI1
Alternative Gene Name: EWSR2, SIC-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016087: 90%, ENSRNOG00000008904: 87%
Entrez Gene ID: 2313
Uniprot ID: Q01543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SYLRESSLLAYNTTSHTDQSSRLSVKEDPSYDSVRRGAWGNNMNSGLNKSPPLGGAQTISKNT |
| Documents & Links for Anti FLI1 pAb (ATL-HPA073099) | |
| Datasheet | Anti FLI1 pAb (ATL-HPA073099) Datasheet (External Link) |
| Vendor Page | Anti FLI1 pAb (ATL-HPA073099) at Atlas |
| Documents & Links for Anti FLI1 pAb (ATL-HPA073099) | |
| Datasheet | Anti FLI1 pAb (ATL-HPA073099) Datasheet (External Link) |
| Vendor Page | Anti FLI1 pAb (ATL-HPA073099) |