![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/99529/179121/atl-hpa065030_anti-fli1-pab-atl-hpa065030_60783__09318.1681134748.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: Fli-1 proto-oncogene, ETS transcription factor
Gene Name: FLI1
Alternative Gene Name: EWSR2, SIC-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016087: 90%, ENSRNOG00000008904: 87%
Entrez Gene ID: 2313
Uniprot ID: Q01543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FLI1
Alternative Gene Name: EWSR2, SIC-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016087: 90%, ENSRNOG00000008904: 87%
Entrez Gene ID: 2313
Uniprot ID: Q01543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SYLRESSLLAYNTTSHTDQSSRLSVKEDPSYDSVRRGAWGNNMNSGLNKSPPLGGAQTISKNT |
| Documents & Links for Anti FLI1 pAb (ATL-HPA065030) | |
| Datasheet | Anti FLI1 pAb (ATL-HPA065030) Datasheet (External Link) |
| Vendor Page | Anti FLI1 pAb (ATL-HPA065030) at Atlas |
| Documents & Links for Anti FLI1 pAb (ATL-HPA065030) | |
| Datasheet | Anti FLI1 pAb (ATL-HPA065030) Datasheet (External Link) |
| Vendor Page | Anti FLI1 pAb (ATL-HPA065030) |