Anti FKBP4 pAb (ATL-HPA062857)

Atlas Antibodies

Catalog No: ATL-HPA062857-25

• 

Product Description

Protein Description: FK506 binding protein 4, 59kDa
Gene Name: FKBP4
Alternative Gene Name: FKBP52, FKBP59
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030357: 81%, ENSRNOG00000006444: 81%
Entrez Gene ID: 2288
Uniprot ID: Q02790
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVE
• Gene Sequence: DFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVE
• Gene ID - Mouse: ENSMUSG00000030357
• Gene ID - Rat: ENSRNOG00000006444
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.