Description
Product Description
Protein Description: factor interacting with PAPOLA and CPSF1
Gene Name: FIP1L1
Alternative Gene Name: DKFZp586K0717, FIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029227: 98%, ENSRNOG00000002275: 98%
Entrez Gene ID: 81608
Uniprot ID: Q6UN15
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FIP1L1
Alternative Gene Name: DKFZp586K0717, FIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029227: 98%, ENSRNOG00000002275: 98%
Entrez Gene ID: 81608
Uniprot ID: Q6UN15
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DVHVTIGDIKTGAPQYGSYGTAPVNLNIKTGGRVYGTTGTKVKGVDLDAPGSINGVPLLEVDLDSFEDKPWRKPGADLSDYFNYGFNEDTWK |
Gene Sequence | DVHVTIGDIKTGAPQYGSYGTAPVNLNIKTGGRVYGTTGTKVKGVDLDAPGSINGVPLLEVDLDSFEDKPWRKPGADLSDYFNYGFNEDTWK |
Gene ID - Mouse | ENSMUSG00000029227 |
Gene ID - Rat | ENSRNOG00000002275 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti FIP1L1 pAb (ATL-HPA058202) | |
Datasheet | Anti FIP1L1 pAb (ATL-HPA058202) Datasheet (External Link) |
Vendor Page | Anti FIP1L1 pAb (ATL-HPA058202) at Atlas Antibodies |
Documents & Links for Anti FIP1L1 pAb (ATL-HPA058202) | |
Datasheet | Anti FIP1L1 pAb (ATL-HPA058202) Datasheet (External Link) |
Vendor Page | Anti FIP1L1 pAb (ATL-HPA058202) |