Description
Product Description
Protein Description: folliculogenesis specific bHLH transcription factor
Gene Name: FIGLA
Alternative Gene Name: bHLHc8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030001: 51%, ENSRNOG00000015877: 50%
Entrez Gene ID: 344018
Uniprot ID: Q6QHK4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FIGLA
Alternative Gene Name: bHLHc8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030001: 51%, ENSRNOG00000015877: 50%
Entrez Gene ID: 344018
Uniprot ID: Q6QHK4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SDLLEGAKDSKKQDPDEQSYSNNSSESHTSSARQLSRNITQHISCAFGLKN |
Gene Sequence | SDLLEGAKDSKKQDPDEQSYSNNSSESHTSSARQLSRNITQHISCAFGLKN |
Gene ID - Mouse | ENSMUSG00000030001 |
Gene ID - Rat | ENSRNOG00000015877 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti FIGLA pAb (ATL-HPA071241) | |
Datasheet | Anti FIGLA pAb (ATL-HPA071241) Datasheet (External Link) |
Vendor Page | Anti FIGLA pAb (ATL-HPA071241) at Atlas Antibodies |
Documents & Links for Anti FIGLA pAb (ATL-HPA071241) | |
Datasheet | Anti FIGLA pAb (ATL-HPA071241) Datasheet (External Link) |
Vendor Page | Anti FIGLA pAb (ATL-HPA071241) |