Anti FIGLA pAb (ATL-HPA071241)

Atlas Antibodies

Catalog No: ATL-HPA071241-25

• 

Product Description

Protein Description: folliculogenesis specific bHLH transcription factor
Gene Name: FIGLA
Alternative Gene Name: bHLHc8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030001: 51%, ENSRNOG00000015877: 50%
Entrez Gene ID: 344018
Uniprot ID: Q6QHK4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SDLLEGAKDSKKQDPDEQSYSNNSSESHTSSARQLSRNITQHISCAFGLKN
• Gene Sequence: SDLLEGAKDSKKQDPDEQSYSNNSSESHTSSARQLSRNITQHISCAFGLKN
• Gene ID - Mouse: ENSMUSG00000030001
• Gene ID - Rat: ENSRNOG00000015877
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.