Protein Description: FIC domain containing
Gene Name: FICD
Alternative Gene Name: HIP13, HYPE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053334: 97%, ENSRNOG00000059799: 93%
Entrez Gene ID: 11153
Uniprot ID: Q9BVA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FICD
Alternative Gene Name: HIP13, HYPE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053334: 97%, ENSRNOG00000059799: 93%
Entrez Gene ID: 11153
Uniprot ID: Q9BVA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VKKVMSIPKGNSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISD |
| Documents & Links for Anti FICD pAb (ATL-HPA071134) | |
| Datasheet | Anti FICD pAb (ATL-HPA071134) Datasheet (External Link) |
| Vendor Page | Anti FICD pAb (ATL-HPA071134) at Atlas |
| Documents & Links for Anti FICD pAb (ATL-HPA071134) | |
| Datasheet | Anti FICD pAb (ATL-HPA071134) Datasheet (External Link) |
| Vendor Page | Anti FICD pAb (ATL-HPA071134) |