Anti FGFRL1 pAb (ATL-HPA068828)

Atlas Antibodies

Catalog No: ATL-HPA068828-25

• 

Product Description

Protein Description: fibroblast growth factor receptor-like 1
Gene Name: FGFRL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008090: 92%, ENSRNOG00000024207: 89%
Entrez Gene ID: 53834
Uniprot ID: Q8N441
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KATNGFGSLSVNYTLVVLDDISPGKESLGPDSSSGGQEDPASQQWARPRFTQPSKMRRRVIARPVGSSVRLKCVAS
• Gene Sequence: KATNGFGSLSVNYTLVVLDDISPGKESLGPDSSSGGQEDPASQQWARPRFTQPSKMRRRVIARPVGSSVRLKCVAS
• Gene ID - Mouse: ENSMUSG00000008090
• Gene ID - Rat: ENSRNOG00000024207
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.