Protein Description: fibroblast growth factor receptor-like 1
Gene Name: FGFRL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008090: 92%, ENSRNOG00000024207: 89%
Entrez Gene ID: 53834
Uniprot ID: Q8N441
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FGFRL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008090: 92%, ENSRNOG00000024207: 89%
Entrez Gene ID: 53834
Uniprot ID: Q8N441
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KATNGFGSLSVNYTLVVLDDISPGKESLGPDSSSGGQEDPASQQWARPRFTQPSKMRRRVIARPVGSSVRLKCVAS |
Documents & Links for Anti FGFRL1 pAb (ATL-HPA068828) | |
Datasheet | Anti FGFRL1 pAb (ATL-HPA068828) Datasheet (External Link) |
Vendor Page | Anti FGFRL1 pAb (ATL-HPA068828) at Atlas |
Documents & Links for Anti FGFRL1 pAb (ATL-HPA068828) | |
Datasheet | Anti FGFRL1 pAb (ATL-HPA068828) Datasheet (External Link) |
Vendor Page | Anti FGFRL1 pAb (ATL-HPA068828) |