Anti FGFR1OP pAb (ATL-HPA071876)

Catalog No:
ATL-HPA071876-25
$303.00

Description

Product Description

Protein Description: FGFR1 oncogene partner
Gene Name: FGFR1OP
Alternative Gene Name: FOP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069135: 84%, ENSRNOG00000055093: 84%
Entrez Gene ID: 11116
Uniprot ID: O95684
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GDSFFDDPIPKPEKTYGLRKEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVL
Gene Sequence GDSFFDDPIPKPEKTYGLRKEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVL
Gene ID - Mouse ENSMUSG00000069135
Gene ID - Rat ENSRNOG00000055093
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti FGFR1OP pAb (ATL-HPA071876)
Datasheet Anti FGFR1OP pAb (ATL-HPA071876) Datasheet (External Link)
Vendor Page Anti FGFR1OP pAb (ATL-HPA071876) at Atlas Antibodies

Documents & Links for Anti FGFR1OP pAb (ATL-HPA071876)
Datasheet Anti FGFR1OP pAb (ATL-HPA071876) Datasheet (External Link)
Vendor Page Anti FGFR1OP pAb (ATL-HPA071876)

Citations

Citations for Anti FGFR1OP pAb (ATL-HPA071876) – 1 Found
Steib, Emmanuelle; Laporte, Marine H; Gambarotto, Davide; Olieric, Natacha; Zheng, Celine; Borgers, Susanne; Olieric, Vincent; Le Guennec, Maeva; Koll, France; Tassin, Anne-Marie; Steinmetz, Michel O; Guichard, Paul; Hamel, Virginie. WDR90 is a centriolar microtubule wall protein important for centriole architecture integrity. Elife. 2020;9( 32946374)  PubMed

Product Description

Protein Description: FGFR1 oncogene partner
Gene Name: FGFR1OP
Alternative Gene Name: FOP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069135: 84%, ENSRNOG00000055093: 84%
Entrez Gene ID: 11116
Uniprot ID: O95684
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GDSFFDDPIPKPEKTYGLRKEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVL
Gene Sequence GDSFFDDPIPKPEKTYGLRKEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVL
Gene ID - Mouse ENSMUSG00000069135
Gene ID - Rat ENSRNOG00000055093
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti FGFR1OP pAb (ATL-HPA071876)
Datasheet Anti FGFR1OP pAb (ATL-HPA071876) Datasheet (External Link)
Vendor Page Anti FGFR1OP pAb (ATL-HPA071876) at Atlas Antibodies

Documents & Links for Anti FGFR1OP pAb (ATL-HPA071876)
Datasheet Anti FGFR1OP pAb (ATL-HPA071876) Datasheet (External Link)
Vendor Page Anti FGFR1OP pAb (ATL-HPA071876)

Citations

Citations for Anti FGFR1OP pAb (ATL-HPA071876) – 1 Found
Steib, Emmanuelle; Laporte, Marine H; Gambarotto, Davide; Olieric, Natacha; Zheng, Celine; Borgers, Susanne; Olieric, Vincent; Le Guennec, Maeva; Koll, France; Tassin, Anne-Marie; Steinmetz, Michel O; Guichard, Paul; Hamel, Virginie. WDR90 is a centriolar microtubule wall protein important for centriole architecture integrity. Elife. 2020;9( 32946374)  PubMed