Anti FGFR1 pAb (ATL-HPA056402)

Catalog No:
ATL-HPA056402-25
$328.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: fibroblast growth factor receptor 1
Gene Name: FGFR1
Alternative Gene Name: BFGFR, CD331, CEK, FLG, FLT2, H2, H3, H4, H5, KAL2, N-SAM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031565: 94%, ENSRNOG00000016050: 96%
Entrez Gene ID: 2260
Uniprot ID: P11362
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence LPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTR
Gene ID - Mouse ENSMUSG00000031565
Gene ID - Rat ENSMUSG00000031565
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti FGFR1 pAb (ATL-HPA056402)
Datasheet Anti FGFR1 pAb (ATL-HPA056402) Datasheet (External Link)
Vendor Page Anti FGFR1 pAb (ATL-HPA056402) at Atlas

Documents & Links for Anti FGFR1 pAb (ATL-HPA056402)
Datasheet Anti FGFR1 pAb (ATL-HPA056402) Datasheet (External Link)
Vendor Page Anti FGFR1 pAb (ATL-HPA056402)

Citations for Anti FGFR1 pAb (ATL-HPA056402) – 2 Found
Akhand, Saeed S; Chen, Hao; Purdy, Stephen Connor; Liu, Zian; Anderson, Joshua C; Willey, Christopher D; Wendt, Michael K. Fibroblast growth factor receptor facilitates recurrence of minimal residual disease following trastuzumab emtansine therapy. Npj Breast Cancer. 2021;7(1):5.  PubMed
Pei, Fei; Ma, Li; Jing, Junjun; Feng, Jifan; Yuan, Yuan; Guo, Tingwei; Han, Xia; Ho, Thach-Vu; Lei, Jie; He, Jinzhi; Zhang, Mingyi; Chen, Jian-Fu; Chai, Yang. Sensory nerve niche regulates mesenchymal stem cell homeostasis via FGF/mTOR/autophagy axis. Nature Communications. 2023;14(1):344.  PubMed