Protein Description: fibroblast growth factor 9
Gene Name: FGF9
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021974: 98%, ENSRNOG00000011471: 98%
Entrez Gene ID: 2254
Uniprot ID: P31371
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FGF9
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021974: 98%, ENSRNOG00000011471: 98%
Entrez Gene ID: 2254
Uniprot ID: P31371
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILR |
| Documents & Links for Anti FGF9 pAb (ATL-HPA067007 w/enhanced validation) | |
| Datasheet | Anti FGF9 pAb (ATL-HPA067007 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FGF9 pAb (ATL-HPA067007 w/enhanced validation) at Atlas |
| Documents & Links for Anti FGF9 pAb (ATL-HPA067007 w/enhanced validation) | |
| Datasheet | Anti FGF9 pAb (ATL-HPA067007 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FGF9 pAb (ATL-HPA067007 w/enhanced validation) |