Anti FGF21 pAb (ATL-HPA061286)

Atlas Antibodies

Catalog No: ATL-HPA061286-25

• 

Product Description

Protein Description: fibroblast growth factor 21
Gene Name: FGF21
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030827: 89%, ENSRNOG00000020990: 86%
Entrez Gene ID: 26291
Uniprot ID: Q9NSA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKS
• Gene Sequence: PGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKS
• Gene ID - Mouse: ENSMUSG00000030827
• Gene ID - Rat: ENSRNOG00000020990
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.