Description
Product Description
Protein Description: fibroblast growth factor 21
Gene Name: FGF21
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030827: 89%, ENSRNOG00000020990: 86%
Entrez Gene ID: 26291
Uniprot ID: Q9NSA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FGF21
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030827: 89%, ENSRNOG00000020990: 86%
Entrez Gene ID: 26291
Uniprot ID: Q9NSA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKS |
Gene Sequence | PGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKS |
Gene ID - Mouse | ENSMUSG00000030827 |
Gene ID - Rat | ENSRNOG00000020990 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti FGF21 pAb (ATL-HPA061286) | |
Datasheet | Anti FGF21 pAb (ATL-HPA061286) Datasheet (External Link) |
Vendor Page | Anti FGF21 pAb (ATL-HPA061286) at Atlas Antibodies |
Documents & Links for Anti FGF21 pAb (ATL-HPA061286) | |
Datasheet | Anti FGF21 pAb (ATL-HPA061286) Datasheet (External Link) |
Vendor Page | Anti FGF21 pAb (ATL-HPA061286) |