Protein Description: fibroblast growth factor 12
Gene Name: FGF12
Alternative Gene Name: FGF12B, FHF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022523: 100%, ENSRNOG00000001931: 100%
Entrez Gene ID: 2257
Uniprot ID: P61328
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FGF12
Alternative Gene Name: FGF12B, FHF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022523: 100%, ENSRNOG00000001931: 100%
Entrez Gene ID: 2257
Uniprot ID: P61328
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDS |
| Documents & Links for Anti FGF12 pAb (ATL-HPA071557) | |
| Datasheet | Anti FGF12 pAb (ATL-HPA071557) Datasheet (External Link) |
| Vendor Page | Anti FGF12 pAb (ATL-HPA071557) at Atlas |
| Documents & Links for Anti FGF12 pAb (ATL-HPA071557) | |
| Datasheet | Anti FGF12 pAb (ATL-HPA071557) Datasheet (External Link) |
| Vendor Page | Anti FGF12 pAb (ATL-HPA071557) |