Protein Description: fibroblast growth factor 11
Gene Name: FGF11
Alternative Gene Name: FHF3, FLJ16061, MGC102953, MGC45269
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042826: 100%, ENSRNOG00000014882: 100%
Entrez Gene ID: 2256
Uniprot ID: Q92914
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FGF11
Alternative Gene Name: FHF3, FLJ16061, MGC102953, MGC45269
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042826: 100%, ENSRNOG00000014882: 100%
Entrez Gene ID: 2256
Uniprot ID: Q92914
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFN |
| Documents & Links for Anti FGF11 pAb (ATL-HPA066605) | |
| Datasheet | Anti FGF11 pAb (ATL-HPA066605) Datasheet (External Link) |
| Vendor Page | Anti FGF11 pAb (ATL-HPA066605) at Atlas |
| Documents & Links for Anti FGF11 pAb (ATL-HPA066605) | |
| Datasheet | Anti FGF11 pAb (ATL-HPA066605) Datasheet (External Link) |
| Vendor Page | Anti FGF11 pAb (ATL-HPA066605) |