Description
Product Description
Protein Description: FYVE, RhoGEF and PH domain containing 5
Gene Name: FGD5
Alternative Gene Name: FLJ00274, FLJ39957, ZFYVE23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034037: 92%, ENSRNOG00000010213: 93%
Entrez Gene ID: 152273
Uniprot ID: Q6ZNL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FGD5
Alternative Gene Name: FLJ00274, FLJ39957, ZFYVE23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034037: 92%, ENSRNOG00000010213: 93%
Entrez Gene ID: 152273
Uniprot ID: Q6ZNL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NSPQLKSRTGKLRASESPSSLIFYRDGKRKGVPFSRTVSRVESFEDRSRPPFLPLPLTKPRSISFPSADTSDYENIPAMNSDYENIQIPPRRPARAGAFTKLFEDQSRALSTANENDGYVD |
Gene Sequence | NSPQLKSRTGKLRASESPSSLIFYRDGKRKGVPFSRTVSRVESFEDRSRPPFLPLPLTKPRSISFPSADTSDYENIPAMNSDYENIQIPPRRPARAGAFTKLFEDQSRALSTANENDGYVD |
Gene ID - Mouse | ENSMUSG00000034037 |
Gene ID - Rat | ENSRNOG00000010213 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti FGD5 pAb (ATL-HPA014536) | |
Datasheet | Anti FGD5 pAb (ATL-HPA014536) Datasheet (External Link) |
Vendor Page | Anti FGD5 pAb (ATL-HPA014536) at Atlas Antibodies |
Documents & Links for Anti FGD5 pAb (ATL-HPA014536) | |
Datasheet | Anti FGD5 pAb (ATL-HPA014536) Datasheet (External Link) |
Vendor Page | Anti FGD5 pAb (ATL-HPA014536) |