Protein Description: FYVE, RhoGEF and PH domain containing 3
Gene Name: FGD3
Alternative Gene Name: FLJ00004, ZFYVE5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037946: 73%, ENSRNOG00000016225: 72%
Entrez Gene ID: 89846
Uniprot ID: Q5JSP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FGD3
Alternative Gene Name: FLJ00004, ZFYVE5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037946: 73%, ENSRNOG00000016225: 72%
Entrez Gene ID: 89846
Uniprot ID: Q5JSP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EEEKKEWIQIIQATIEKHKQNSETFKAFGGAFSQDEDPSLSPDMPITSTSPVEPVVTTEGSSGAAGLEPRKLSSKTRRDKEKQSCKSCGETFNSITKRRHHCKLC |
| Gene ID - Mouse | ENSMUSG00000037946 |
| Gene ID - Rat | ENSMUSG00000037946 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FGD3 pAb (ATL-HPA021018) | |
| Datasheet | Anti FGD3 pAb (ATL-HPA021018) Datasheet (External Link) |
| Vendor Page | Anti FGD3 pAb (ATL-HPA021018) at Atlas |
| Documents & Links for Anti FGD3 pAb (ATL-HPA021018) | |
| Datasheet | Anti FGD3 pAb (ATL-HPA021018) Datasheet (External Link) |
| Vendor Page | Anti FGD3 pAb (ATL-HPA021018) |