Protein Description: fasciculation and elongation protein zeta 1
Gene Name: FEZ1
Alternative Gene Name: UNC-76
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032118: 98%, ENSRNOG00000006075: 96%
Entrez Gene ID: 9638
Uniprot ID: Q99689
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FEZ1
Alternative Gene Name: UNC-76
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032118: 98%, ENSRNOG00000006075: 96%
Entrez Gene ID: 9638
Uniprot ID: Q99689
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EEEVLEEEDGGETSSQADSVLLQEMQALTQTFNNNWSYEGLRHMSGSELTE |
| Documents & Links for Anti FEZ1 pAb (ATL-HPA076844) | |
| Datasheet | Anti FEZ1 pAb (ATL-HPA076844) Datasheet (External Link) |
| Vendor Page | Anti FEZ1 pAb (ATL-HPA076844) at Atlas |
| Documents & Links for Anti FEZ1 pAb (ATL-HPA076844) | |
| Datasheet | Anti FEZ1 pAb (ATL-HPA076844) Datasheet (External Link) |
| Vendor Page | Anti FEZ1 pAb (ATL-HPA076844) |