Description
Product Description
Protein Description: fasciculation and elongation protein zeta 1
Gene Name: FEZ1
Alternative Gene Name: UNC-76
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032118: 98%, ENSRNOG00000006075: 96%
Entrez Gene ID: 9638
Uniprot ID: Q99689
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FEZ1
Alternative Gene Name: UNC-76
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032118: 98%, ENSRNOG00000006075: 96%
Entrez Gene ID: 9638
Uniprot ID: Q99689
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EEEVLEEEDGGETSSQADSVLLQEMQALTQTFNNNWSYEGLRHMSGSELTE |
Gene Sequence | EEEVLEEEDGGETSSQADSVLLQEMQALTQTFNNNWSYEGLRHMSGSELTE |
Gene ID - Mouse | ENSMUSG00000032118 |
Gene ID - Rat | ENSRNOG00000006075 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti FEZ1 pAb (ATL-HPA076844) | |
Datasheet | Anti FEZ1 pAb (ATL-HPA076844) Datasheet (External Link) |
Vendor Page | Anti FEZ1 pAb (ATL-HPA076844) at Atlas Antibodies |
Documents & Links for Anti FEZ1 pAb (ATL-HPA076844) | |
Datasheet | Anti FEZ1 pAb (ATL-HPA076844) Datasheet (External Link) |
Vendor Page | Anti FEZ1 pAb (ATL-HPA076844) |