Anti FEZ1 pAb (ATL-HPA076844)

Atlas Antibodies

Catalog No: ATL-HPA076844-25

• 

Product Description

Protein Description: fasciculation and elongation protein zeta 1
Gene Name: FEZ1
Alternative Gene Name: UNC-76
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032118: 98%, ENSRNOG00000006075: 96%
Entrez Gene ID: 9638
Uniprot ID: Q99689
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEEVLEEEDGGETSSQADSVLLQEMQALTQTFNNNWSYEGLRHMSGSELTE
• Gene Sequence: EEEVLEEEDGGETSSQADSVLLQEMQALTQTFNNNWSYEGLRHMSGSELTE
• Gene ID - Mouse: ENSMUSG00000032118
• Gene ID - Rat: ENSRNOG00000006075
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.