Anti FERMT2 pAb (ATL-HPA072965)

Atlas Antibodies

Catalog No: ATL-HPA072965-25

• 

Product Description

Protein Description: fermitin family member 2
Gene Name: FERMT2
Alternative Gene Name: KIND2, mig-2, PLEKHC1, UNC112B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037712: 98%, ENSRNOG00000009102: 98%
Entrez Gene ID: 10979
Uniprot ID: Q96AC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPEILAKMFKPQALLDK
• Gene Sequence: YDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPEILAKMFKPQALLDK
• Gene ID - Mouse: ENSMUSG00000037712
• Gene ID - Rat: ENSRNOG00000009102
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.