Protein Description: fermitin family member 2
Gene Name: FERMT2
Alternative Gene Name: KIND2, mig-2, PLEKHC1, UNC112B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037712: 98%, ENSRNOG00000009102: 98%
Entrez Gene ID: 10979
Uniprot ID: Q96AC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FERMT2
Alternative Gene Name: KIND2, mig-2, PLEKHC1, UNC112B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037712: 98%, ENSRNOG00000009102: 98%
Entrez Gene ID: 10979
Uniprot ID: Q96AC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPEILAKMFKPQALLDK |
| Documents & Links for Anti FERMT2 pAb (ATL-HPA072965) | |
| Datasheet | Anti FERMT2 pAb (ATL-HPA072965) Datasheet (External Link) |
| Vendor Page | Anti FERMT2 pAb (ATL-HPA072965) at Atlas |
| Documents & Links for Anti FERMT2 pAb (ATL-HPA072965) | |
| Datasheet | Anti FERMT2 pAb (ATL-HPA072965) Datasheet (External Link) |
| Vendor Page | Anti FERMT2 pAb (ATL-HPA072965) |