Protein Description: FCH domain only 2
Gene Name: FCHO2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041685: 87%, ENSRNOG00000015334: 87%
Entrez Gene ID: 115548
Uniprot ID: Q0JRZ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FCHO2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041685: 87%, ENSRNOG00000015334: 87%
Entrez Gene ID: 115548
Uniprot ID: Q0JRZ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KVSIGNITLSPAISRHSPVQMNRNLSNEELTKSKPSAPPNEKGTSDLLAWDPLFGPSLDSSS |
Documents & Links for Anti FCHO2 pAb (ATL-HPA077850) | |
Datasheet | Anti FCHO2 pAb (ATL-HPA077850) Datasheet (External Link) |
Vendor Page | Anti FCHO2 pAb (ATL-HPA077850) at Atlas |
Documents & Links for Anti FCHO2 pAb (ATL-HPA077850) | |
Datasheet | Anti FCHO2 pAb (ATL-HPA077850) Datasheet (External Link) |
Vendor Page | Anti FCHO2 pAb (ATL-HPA077850) |