Anti FCHO1 pAb (ATL-HPA062981)

Atlas Antibodies

Catalog No: ATL-HPA062981-25

• 

Product Description

Protein Description: FCH domain only 1
Gene Name: FCHO1
Alternative Gene Name: KIAA0290
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070000: 86%, ENSRNOG00000033912: 85%
Entrez Gene ID: 23149
Uniprot ID: O14526
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGPQSVPLQLSAHWQCGATLTQVSVEYGYRPGATAVPTPLTNVQILLPVGEPVTNVRLQPAATWNLEEKRLTW
• Gene Sequence: PGPQSVPLQLSAHWQCGATLTQVSVEYGYRPGATAVPTPLTNVQILLPVGEPVTNVRLQPAATWNLEEKRLTW
• Gene ID - Mouse: ENSMUSG00000070000
• Gene ID - Rat: ENSRNOG00000033912
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.