Description
Product Description
Protein Description: Fc fragment of IgE receptor II
Gene Name: FCER2
Alternative Gene Name: CD23, CD23A, CLEC4J, FCE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005540: 56%, ENSRNOG00000001005: 59%
Entrez Gene ID: 2208
Uniprot ID: P06734
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FCER2
Alternative Gene Name: CD23, CD23A, CLEC4J, FCE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005540: 56%, ENSRNOG00000001005: 59%
Entrez Gene ID: 2208
Uniprot ID: P06734
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGT |
Gene Sequence | LKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGT |
Gene ID - Mouse | ENSMUSG00000005540 |
Gene ID - Rat | ENSRNOG00000001005 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti FCER2 pAb (ATL-HPA067430 w/enhanced validation) | |
Datasheet | Anti FCER2 pAb (ATL-HPA067430 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FCER2 pAb (ATL-HPA067430 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti FCER2 pAb (ATL-HPA067430 w/enhanced validation) | |
Datasheet | Anti FCER2 pAb (ATL-HPA067430 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FCER2 pAb (ATL-HPA067430 w/enhanced validation) |