Protein Description: Fc fragment of IgA and IgM receptor
Gene Name: FCAMR
Alternative Gene Name: CD351, FCA/MR, FKSG87
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026415: 50%, ENSRNOG00000004393: 47%
Entrez Gene ID: 83953
Uniprot ID: Q8WWV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FCAMR
Alternative Gene Name: CD351, FCA/MR, FKSG87
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026415: 50%, ENSRNOG00000004393: 47%
Entrez Gene ID: 83953
Uniprot ID: Q8WWV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | HPRWLWEGSLPSRTHLRAMGTLRPSSPLCWREESSFAAPNSLKGSRLVSGEPGGAVTIQCHYA |
Documents & Links for Anti FCAMR pAb (ATL-HPA056505 w/enhanced validation) | |
Datasheet | Anti FCAMR pAb (ATL-HPA056505 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FCAMR pAb (ATL-HPA056505 w/enhanced validation) at Atlas |
Documents & Links for Anti FCAMR pAb (ATL-HPA056505 w/enhanced validation) | |
Datasheet | Anti FCAMR pAb (ATL-HPA056505 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FCAMR pAb (ATL-HPA056505 w/enhanced validation) |