Protein Description: F-box and WD repeat domain containing 2
Gene Name: FBXW2
Alternative Gene Name: FBW2, Fwd2, Md6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035949: 99%, ENSRNOG00000018687: 100%
Entrez Gene ID: 26190
Uniprot ID: Q9UKT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FBXW2
Alternative Gene Name: FBW2, Fwd2, Md6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035949: 99%, ENSRNOG00000018687: 100%
Entrez Gene ID: 26190
Uniprot ID: Q9UKT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LYIMDLRTESLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSIHLVLWKEHG |
Documents & Links for Anti FBXW2 pAb (ATL-HPA067878) | |
Datasheet | Anti FBXW2 pAb (ATL-HPA067878) Datasheet (External Link) |
Vendor Page | Anti FBXW2 pAb (ATL-HPA067878) at Atlas |
Documents & Links for Anti FBXW2 pAb (ATL-HPA067878) | |
Datasheet | Anti FBXW2 pAb (ATL-HPA067878) Datasheet (External Link) |
Vendor Page | Anti FBXW2 pAb (ATL-HPA067878) |