Anti FBXO21 pAb (ATL-HPA071452)

Atlas Antibodies

Catalog No: ATL-HPA071452-25

• 

Product Description

Protein Description: F-box protein 21
Gene Name: FBXO21
Alternative Gene Name: FBX21, KIAA0875
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032898: 98%, ENSRNOG00000001129: 93%
Entrez Gene ID: 23014
Uniprot ID: O94952
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CLVLKVLDILQHIQTLDPGQHGAVGYLVQHTLEHIERKKEEVGVEVKLRSDEKHRDVCYSIGLIMKHKRYGYNCVIYGWD
• Gene Sequence: CLVLKVLDILQHIQTLDPGQHGAVGYLVQHTLEHIERKKEEVGVEVKLRSDEKHRDVCYSIGLIMKHKRYGYNCVIYGWD
• Gene ID - Mouse: ENSMUSG00000032898
• Gene ID - Rat: ENSRNOG00000001129
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.