Protein Description: F-box protein 21
Gene Name: FBXO21
Alternative Gene Name: FBX21, KIAA0875
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032898: 98%, ENSRNOG00000001129: 93%
Entrez Gene ID: 23014
Uniprot ID: O94952
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FBXO21
Alternative Gene Name: FBX21, KIAA0875
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032898: 98%, ENSRNOG00000001129: 93%
Entrez Gene ID: 23014
Uniprot ID: O94952
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | CLVLKVLDILQHIQTLDPGQHGAVGYLVQHTLEHIERKKEEVGVEVKLRSDEKHRDVCYSIGLIMKHKRYGYNCVIYGWD |
| Documents & Links for Anti FBXO21 pAb (ATL-HPA071452) | |
| Datasheet | Anti FBXO21 pAb (ATL-HPA071452) Datasheet (External Link) |
| Vendor Page | Anti FBXO21 pAb (ATL-HPA071452) at Atlas |
| Documents & Links for Anti FBXO21 pAb (ATL-HPA071452) | |
| Datasheet | Anti FBXO21 pAb (ATL-HPA071452) Datasheet (External Link) |
| Vendor Page | Anti FBXO21 pAb (ATL-HPA071452) |