Anti FBXL3 pAb (ATL-HPA065626)

Catalog No:
ATL-HPA065626-25
$401.00
Protein Description: F-box and leucine-rich repeat protein 3
Gene Name: FBXL3
Alternative Gene Name: FBL3, FBL3A, FBXL3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022124: 100%, ENSRNOG00000059334: 100%
Entrez Gene ID: 26224
Uniprot ID: Q9UKT7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence FEFELNQPATSYLKATHPELIKQIIKRHSNHLQYVSFKVDSSKESAEAACDILSQLVNCSLKTLGLISTARPSFMDLP

Documents & Links for Anti FBXL3 pAb (ATL-HPA065626)
Datasheet Anti FBXL3 pAb (ATL-HPA065626) Datasheet (External Link)
Vendor Page Anti FBXL3 pAb (ATL-HPA065626) at Atlas

Documents & Links for Anti FBXL3 pAb (ATL-HPA065626)
Datasheet Anti FBXL3 pAb (ATL-HPA065626) Datasheet (External Link)
Vendor Page Anti FBXL3 pAb (ATL-HPA065626)