Description
Product Description
Protein Description: F-box and leucine-rich repeat protein 3
Gene Name: FBXL3
Alternative Gene Name: FBL3, FBL3A, FBXL3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022124: 100%, ENSRNOG00000059334: 100%
Entrez Gene ID: 26224
Uniprot ID: Q9UKT7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FBXL3
Alternative Gene Name: FBL3, FBL3A, FBXL3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022124: 100%, ENSRNOG00000059334: 100%
Entrez Gene ID: 26224
Uniprot ID: Q9UKT7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FEFELNQPATSYLKATHPELIKQIIKRHSNHLQYVSFKVDSSKESAEAACDILSQLVNCSLKTLGLISTARPSFMDLP |
Gene Sequence | FEFELNQPATSYLKATHPELIKQIIKRHSNHLQYVSFKVDSSKESAEAACDILSQLVNCSLKTLGLISTARPSFMDLP |
Gene ID - Mouse | ENSMUSG00000022124 |
Gene ID - Rat | ENSRNOG00000059334 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti FBXL3 pAb (ATL-HPA065626) | |
Datasheet | Anti FBXL3 pAb (ATL-HPA065626) Datasheet (External Link) |
Vendor Page | Anti FBXL3 pAb (ATL-HPA065626) at Atlas Antibodies |
Documents & Links for Anti FBXL3 pAb (ATL-HPA065626) | |
Datasheet | Anti FBXL3 pAb (ATL-HPA065626) Datasheet (External Link) |
Vendor Page | Anti FBXL3 pAb (ATL-HPA065626) |