Protein Description: F-box and leucine rich repeat protein 19
Gene Name: FBXL19
Alternative Gene Name: CXXC11, DKFZp434K0410, Fbl19, JHDM1C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030811: 96%, ENSRNOG00000018986: 96%
Entrez Gene ID: 54620
Uniprot ID: Q6PCT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FBXL19
Alternative Gene Name: CXXC11, DKFZp434K0410, Fbl19, JHDM1C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030811: 96%, ENSRNOG00000018986: 96%
Entrez Gene ID: 54620
Uniprot ID: Q6PCT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GNEPPTPRKKVKGGRERHLKKVGGDACLLRGSDPGGPGLLPPRVLNPSQAFSSCHPGLPPENWEKPKPPLASAEGP |
Documents & Links for Anti FBXL19 pAb (ATL-HPA074250) | |
Datasheet | Anti FBXL19 pAb (ATL-HPA074250) Datasheet (External Link) |
Vendor Page | Anti FBXL19 pAb (ATL-HPA074250) at Atlas |
Documents & Links for Anti FBXL19 pAb (ATL-HPA074250) | |
Datasheet | Anti FBXL19 pAb (ATL-HPA074250) Datasheet (External Link) |
Vendor Page | Anti FBXL19 pAb (ATL-HPA074250) |