Anti FBXL19 pAb (ATL-HPA074250)

Catalog No:
ATL-HPA074250-25
$447.00

Description

Product Description

Protein Description: F-box and leucine rich repeat protein 19
Gene Name: FBXL19
Alternative Gene Name: CXXC11, DKFZp434K0410, Fbl19, JHDM1C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030811: 96%, ENSRNOG00000018986: 96%
Entrez Gene ID: 54620
Uniprot ID: Q6PCT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GNEPPTPRKKVKGGRERHLKKVGGDACLLRGSDPGGPGLLPPRVLNPSQAFSSCHPGLPPENWEKPKPPLASAEGP
Gene Sequence GNEPPTPRKKVKGGRERHLKKVGGDACLLRGSDPGGPGLLPPRVLNPSQAFSSCHPGLPPENWEKPKPPLASAEGP
Gene ID - Mouse ENSMUSG00000030811
Gene ID - Rat ENSRNOG00000018986
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti FBXL19 pAb (ATL-HPA074250)
Datasheet Anti FBXL19 pAb (ATL-HPA074250) Datasheet (External Link)
Vendor Page Anti FBXL19 pAb (ATL-HPA074250) at Atlas Antibodies

Documents & Links for Anti FBXL19 pAb (ATL-HPA074250)
Datasheet Anti FBXL19 pAb (ATL-HPA074250) Datasheet (External Link)
Vendor Page Anti FBXL19 pAb (ATL-HPA074250)

Product Description

Protein Description: F-box and leucine rich repeat protein 19
Gene Name: FBXL19
Alternative Gene Name: CXXC11, DKFZp434K0410, Fbl19, JHDM1C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030811: 96%, ENSRNOG00000018986: 96%
Entrez Gene ID: 54620
Uniprot ID: Q6PCT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GNEPPTPRKKVKGGRERHLKKVGGDACLLRGSDPGGPGLLPPRVLNPSQAFSSCHPGLPPENWEKPKPPLASAEGP
Gene Sequence GNEPPTPRKKVKGGRERHLKKVGGDACLLRGSDPGGPGLLPPRVLNPSQAFSSCHPGLPPENWEKPKPPLASAEGP
Gene ID - Mouse ENSMUSG00000030811
Gene ID - Rat ENSRNOG00000018986
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti FBXL19 pAb (ATL-HPA074250)
Datasheet Anti FBXL19 pAb (ATL-HPA074250) Datasheet (External Link)
Vendor Page Anti FBXL19 pAb (ATL-HPA074250) at Atlas Antibodies

Documents & Links for Anti FBXL19 pAb (ATL-HPA074250)
Datasheet Anti FBXL19 pAb (ATL-HPA074250) Datasheet (External Link)
Vendor Page Anti FBXL19 pAb (ATL-HPA074250)