Anti FBLN2 pAb (ATL-HPA001934 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA001934-25

• 
• 

Product Description

Protein Description: fibulin 2
Gene Name: FBLN2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064080: 85%, ENSRNOG00000007338: 85%
Entrez Gene ID: 2199
Uniprot ID: P98095
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLGSFHCYKALTCEPGYALKDGECEDVDECAMGTHTCQPGFLCQNTKGSFYCQARQRCMDGFLQDPEGNCVDINECTSLSEPCRPGFSCINTVGSYTCQRNPLICARGYHASDDGTKCVDVNE
• Gene Sequence: TLGSFHCYKALTCEPGYALKDGECEDVDECAMGTHTCQPGFLCQNTKGSFYCQARQRCMDGFLQDPEGNCVDINECTSLSEPCRPGFSCINTVGSYTCQRNPLICARGYHASDDGTKCVDVNE
• Gene ID - Mouse: ENSMUSG00000064080
• Gene ID - Rat: ENSRNOG00000007338
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti FBLN2 pAb (ATL-HPA001934 w/enhanced validation) – 1 Found

Uyama, Naoki; Iimuro, Yuji; Kawada, Norifumi; Reynaert, Hendrik; Suzumura, Kazuhiro; Hirano, Tadamichi; Kuroda, Nobukazu; Fujimoto, Jiro. Fascin, a novel marker of human hepatic stellate cells, may regulate their proliferation, migration, and collagen gene expression through the FAK-PI3K-Akt pathway. Laboratory Investigation; A Journal Of Technical Methods And Pathology. 2012;92(1):57-71.