Protein Description: FAST kinase domains 3
Gene Name: FASTKD3
Alternative Gene Name: FLJ23274, MGC5297
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021532: 56%, ENSRNOG00000027422: 57%
Entrez Gene ID: 79072
Uniprot ID: Q14CZ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FASTKD3
Alternative Gene Name: FLJ23274, MGC5297
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021532: 56%, ENSRNOG00000027422: 57%
Entrez Gene ID: 79072
Uniprot ID: Q14CZ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | METLPDTMAAGALQRICEVEKKDGDQGLPKEILENSIFQALCFQFEKEPSQLSNTSLVTALQALILLHVDPQSSLLLNLVAECQNRLRKGGMEVRNLCILGESLITLHSSGCVTLELIINQLQG |
Documents & Links for Anti FASTKD3 pAb (ATL-HPA074462) | |
Datasheet | Anti FASTKD3 pAb (ATL-HPA074462) Datasheet (External Link) |
Vendor Page | Anti FASTKD3 pAb (ATL-HPA074462) at Atlas |
Documents & Links for Anti FASTKD3 pAb (ATL-HPA074462) | |
Datasheet | Anti FASTKD3 pAb (ATL-HPA074462) Datasheet (External Link) |
Vendor Page | Anti FASTKD3 pAb (ATL-HPA074462) |